PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Zjn_sc00001.1.g06450.1.am.mk
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; PACMAD clade; Chloridoideae; Zoysieae; Zoysiinae; Zoysia
Family GRAS
Protein Properties Length: 468aa    MW: 50964.8 Da    PI: 6.3542
Description GRAS family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Zjn_sc00001.1.g06450.1.am.mkgenomeZGDView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1GRAS355.96e-109874522373
                          GRAS   2 velLlecAeavssgdlelaqalLarlselaspdgdpmqRlaayfteALaarlarsvselykalppsetseknsseelaalk 82 
                                    +lLl+cAeav+ ++l++a+ lL ++ elasp g++ +R+aayf  AL ar+++s  + y+ l++ +++     +++ a++
  Zjn_sc00001.1.g06450.1.am.mk  87 LTLLLRCAEAVAVDQLTEARDLLPEIAELASPFGSSPERVAAYFGDALCARVLSSYLGAYSPLAAAQSR-----SVAGAFQ 162
                                   579***************************************************999999988888887.....6778999 PP

                          GRAS  83 lfsevsPilkfshltaNqaIleavegeervHiiDfdisqGlQWpaLlqaLasRpegppslRiTgvgspesgskeeleetge 163
                                   +++ +sP++kf+h+taNqaIl+a++ge+r+H++D+di+qGlQWp L++ LasRp+ p slRiTg+g+    s + le+tg+
  Zjn_sc00001.1.g06450.1.am.mk 163 AYNALSPLVKFAHFTANQAILQALDGEDRLHVVDLDIMQGLQWPGLFHILASRPRRPRSLRITGLGA----SLDVLEATGR 239
                                   *******************************************************************....9********* PP

                          GRAS 164 rLakfAeelgvpfefnvl......vakrledleleeL........rvkp....gEalaVnlvlqlhrlldesvsleserde 226
                                   rLa+fA++lg+pfef+++      v       +  +L        +  +    +Ea++V++++  h l+d ++s       
  Zjn_sc00001.1.g06450.1.am.mk 240 RLADFAASLGLPFEFRPVegkighV------ADAAALlgsrdhhhH--QrqqrDEATVVHWMH--HCLYDVTGSDMG---- 306
                                   *****************84444433......344444444444431..23456*********9..888888888888.... PP

                          GRAS 227 vLklvkslsPkvvvvveqeadhnsesFlerflealeyysalfdsl.eaklpreseerikvErellgreivnvvacegaerr 306
                                   +++l+ksl+Pk++++veq++ h s++Fl rf+eal+yysalfd+l +    +e+ er+ vEr+llg ei+n+va  g +r+
  Zjn_sc00001.1.g06450.1.am.mk 307 TVRLLKSLRPKLITIVEQDLGH-SGDFLGRFVEALHYYSALFDALgDGATEKEAAERHAVERQLLGAEIRNIVAVGGPKRT 386
                                   **********************.899*******************766667777*************************99 PP

                          GRAS 307 erhetlekWrerleeaGFkpvplsekaakqaklllrkvksdgyrveeesgslvlgWkdrpLvsvSaW 373
                                    + + +e+W++ l++aGF+pv+l  + a+qa++ll +++ +gy++ ee+ +l lgWkd +L+++SaW
  Zjn_sc00001.1.g06450.1.am.mk 387 GEVR-VERWSDELRRAGFRPVSLAGSPATQARMLLGMYPLKGYTLVEEDWCLRLGWKDLSLLTASAW 452
                                   8887.9************************************************************* PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5098556.79260433IPR005202Transcription factor GRAS
PfamPF035142.1E-10687452IPR005202Transcription factor GRAS
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0048366Biological Processleaf development
GO:0090610Biological Processbundle sheath cell fate specification
GO:0005634Cellular Componentnucleus
Sequence ? help Back to Top
Protein Sequence    Length: 468 aa     Download sequence    Send to blast
MIRVTGNTRN EELLALIDRR PADAMLQGVL SRAPTTTTAT DAAATKAKRP ASAEEEEEEG  60
QERRKRLQAL VVGAEGDGAE TKGLRLLTLL LRCAEAVAVD QLTEARDLLP EIAELASPFG  120
SSPERVAAYF GDALCARVLS SYLGAYSPLA AAQSRSVAGA FQAYNALSPL VKFAHFTANQ  180
AILQALDGED RLHVVDLDIM QGLQWPGLFH ILASRPRRPR SLRITGLGAS LDVLEATGRR  240
LADFAASLGL PFEFRPVEGK IGHVADAAAL LGSRDHHHHQ RQQRDEATVV HWMHHCLYDV  300
TGSDMGTVRL LKSLRPKLIT IVEQDLGHSG DFLGRFVEAL HYYSALFDAL GDGATEKEAA  360
ERHAVERQLL GAEIRNIVAV GGPKRTGEVR VERWSDELRR AGFRPVSLAG SPATQARMLL  420
GMYPLKGYTL VEEDWCLRLG WKDLSLLTAS AWAPADDDDV AAAARHDS
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
5hyz_A6e-49864524374GRAS family transcription factor containing p
Search in ModeBase
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankEU9562380.0EU956238.1 Zea mays clone 1559464 nodulation signaling pathway 2 protein mRNA, complete cds.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_004958062.10.0PREDICTED: scarecrow-like protein 23
SwissprotQ9FHZ11e-164SCL23_ARATH; Scarecrow-like protein 23
TrEMBLK4A1090.0K4A109_SETIT; Uncharacterized protein
TrEMBLM0XSF00.0M0XSF0_HORVD; Uncharacterized protein
STRINGMLOC_62589.10.0(Hordeum vulgare)
STRINGSi032551m0.0(Setaria italica)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MonocotsOGMP137138122
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT5G41920.11e-145GRAS family protein